"DKK3" Related Products

Expand
Expand

Recombinant Human DKK3, His-tagged

Cat.No.: DKK3-26024TH
Product Overview: Recombinant fragment, corresponding to amino acids 33-350 of Human 350 aa isoform DKK3 with N terminal His tag, Predicted MWt 36 kDa.
Description: This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEM EAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIH VHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECI IDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCG DQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDR CPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPR EVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAA AAALLGGEEI
Gene Name: DKK3 dickkopf 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol: DKK3
Synonyms: DKK3; dickkopf 3 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 3; dickkopf-related protein 3; regulated in glioma; REIC; RIG;
Gene ID: 27122
mRNA Refseq: NM_001018057
Protein Refseq: NP_001018067
MIM: 605416
Uniprot ID: Q9UBP4
Chromosome Location: 11p15.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.