"DLX3" Related Products

Expand
Expand

Recombinant Human DLX3

Cat.No.: DLX3-26675TH
Product Overview: Recombinant full length Human DLX3 with N terminal proprietary tag, predicted mwt: 57.31 kDa.
Description: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Protein length: 287 amino acids
Molecular Weight: 57.310kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDL GYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAY SPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERA ELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP PNPGAVY
Sequence Similarities: Belongs to the distal-less homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: DLX3 distal-less homeobox 3 [ Homo sapiens ]
Official Symbol: DLX3
Synonyms: DLX3; distal-less homeobox 3; distal less homeo box 3; homeobox protein DLX-3;
Gene ID: 1747
mRNA Refseq: NM_005220
Protein Refseq: NP_005211
MIM: 600525
Uniprot ID: O60479
Chromosome Location: 17q21.33
Function: sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.