"DNAJC2" Related Products

Expand

Recombinant Human DNAJC2, His-tagged

Cat.No.: DNAJC2-26774TH
Product Overview: Recombinant fragment, corresponding to amino acids 189-621 of Human DNAJC2 with N terminal His tag; Predicted MWt 51kDa.
Description: This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFS YLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRI RTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRK EQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEK DIQKKAIKKERQKLRNSCKTWNHFSDNEAERVKMMEEVEK LCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDD LQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTA KDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQ ADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTP ERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQ VLNASRAKK
Sequence Similarities: Contains 1 J domain.Contains 2 SANT domains.
Gene Name: DNAJC2 DnaJ (Hsp40) homolog, subfamily C, member 2 [ Homo sapiens ]
Official Symbol: DNAJC2
Synonyms: DNAJC2; DnaJ (Hsp40) homolog, subfamily C, member 2; ZRF1, zuotin related factor 1; dnaJ homolog subfamily C member 2; MPHOSPH11; MPP11; ZUO1; zuotin;
Gene ID: 27000
mRNA Refseq: NM_014377
Protein Refseq: NP_055192
MIM: 605502
Uniprot ID: Q99543
Chromosome Location: 7q22-q32
Function: DNA binding; Hsp70 protein binding; chromatin binding; histone binding; ubiquitin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.