Recombinant Human DOCK7, His-tagged DOCK7-28082TH

Recombinant Human DOCK7, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DOCK7, His-tagged

Recombinant Human DOCK7, His-tagged

DOCK7 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DOCK7-28082TH
Product Overview : Recombinant fragment, corresponding to amino acids 1823-2109 of Human DOCK7 with a N terminal His tag; predicted MWt 35 kDa:
Description : DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 Ser-15 phosphorylation during axon formation and consequently for neuronal polarization.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 69 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVI KDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITY FDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTT SHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAF ATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGP DQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPV TCHRDSFSRMSLRKMDL
Gene Name : DOCK7 dedicator of cytokinesis 7 [ Homo sapiens ]
Official Symbol : DOCK7
Synonyms : DOCK7; dedicator of cytokinesis 7; dedicator of cytokinesis protein 7; KIAA1771; ZIR2;
Gene ID : 85440
mRNA Refseq : NM_033407
Protein Refseq : NP_212132
Uniprot ID : Q96N67
Chromosome Location : 1p32.1
Pathway : ErbB2/ErbB3 signaling events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : GTP binding; GTPase binding; Rac GTPase binding; guanyl-nucleotide exchange factor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy