"DOCK7" Related Products

Recombinant Human DOCK7, His-tagged

Cat.No.: DOCK7-28082TH
Product Overview: Recombinant fragment, corresponding to amino acids 1823-2109 of Human DOCK7 with a N terminal His tag; predicted MWt 35 kDa:
Description: DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 Ser-15 phosphorylation during axon formation and consequently for neuronal polarization.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 69 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVI KDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITY FDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTT SHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAF ATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGP DQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPV TCHRDSFSRMSLRKMDL
Gene Name: DOCK7 dedicator of cytokinesis 7 [ Homo sapiens ]
Official Symbol: DOCK7
Synonyms: DOCK7; dedicator of cytokinesis 7; dedicator of cytokinesis protein 7; KIAA1771; ZIR2;
Gene ID: 85440
mRNA Refseq: NM_033407
Protein Refseq: NP_212132
Uniprot ID: Q96N67
Chromosome Location: 1p32.1
Pathway: ErbB2/ErbB3 signaling events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function: GTP binding; GTPase binding; Rac GTPase binding; guanyl-nucleotide exchange factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.