Recombinant Human DOCK7, His-tagged
Cat.No. : | DOCK7-28082TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1823-2109 of Human DOCK7 with a N terminal His tag; predicted MWt 35 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1823-2109 a.a. |
Description : | DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 Ser-15 phosphorylation during axon formation and consequently for neuronal polarization. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVI KDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITY FDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTT SHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAF ATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSE IPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGP DQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPV TCHRDSFSRMSLRKMDL |
Gene Name | DOCK7 dedicator of cytokinesis 7 [ Homo sapiens ] |
Official Symbol | DOCK7 |
Synonyms | DOCK7; dedicator of cytokinesis 7; dedicator of cytokinesis protein 7; KIAA1771; ZIR2; |
Gene ID | 85440 |
mRNA Refseq | NM_033407 |
Protein Refseq | NP_212132 |
Uniprot ID | Q96N67 |
Chromosome Location | 1p32.1 |
Pathway | ErbB2/ErbB3 signaling events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | GTP binding; GTPase binding; Rac GTPase binding; guanyl-nucleotide exchange factor activity; |
◆ Recombinant Proteins | ||
DOCK7-1370H | Recombinant Human DOCK7 Protein, His-tagged | +Inquiry |
DOCK7-28082TH | Recombinant Human DOCK7, His-tagged | +Inquiry |
Dock7-1371R | Recombinant Rat Dock7 Protein, His-tagged | +Inquiry |
DOCK7-2808H | Recombinant Human DOCK7 Protein, GST-tagged | +Inquiry |
DOCK7-3936HF | Recombinant Full Length Human DOCK7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOCK7-504HCL | Recombinant Human DOCK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOCK7 Products
Required fields are marked with *
My Review for All DOCK7 Products
Required fields are marked with *