"DUSP23" Related Products

Expand

Recombinant Human DUSP23, His-tagged

Cat.No.: DUSP23-26909TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-150 of Human DUSP23, with an N-terminal His tag, 170aa, 18.8 kDa.
Description: DUSP23, also known as low molecular mass dual specificity phosphatase 3(LDP-3), belongs to the protein-tyrosine phosphatase family.
Protein length: 150 amino acids
Conjugation: HIS
Molecular Weight: 18.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLA LPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFG RTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK
Sequence Similarities: Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.
Gene Name: DUSP23 dual specificity phosphatase 23 [ Homo sapiens ]
Official Symbol: DUSP23
Synonyms: DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442;
Gene ID: 54935
mRNA Refseq: NM_017823
Protein Refseq: NP_060293
Uniprot ID: Q9BVJ7
Chromosome Location: 1q23.1
Function: hydrolase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.