Recombinant Human DUSP23 Protein, GST-tagged
Cat.No. : | DUSP23-2936H |
Product Overview : | Human DUSP23 full-length ORF ( NP_060293.2, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DUSP23 (Dual Specificity Phosphatase 23) is a Protein Coding gene. Diseases associated with DUSP23 include Neuronal Intestinal Dysplasia. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is CDC14A. |
Molecular Mass : | 43 kDa |
AA Sequence : | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP23 dual specificity phosphatase 23 [ Homo sapiens ] |
Official Symbol | DUSP23 |
Synonyms | DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; VH1-like member Z; VH1-like phosphatase Z; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; VHZ; MOSP; LDP-3; RP11-190A12.1; |
Gene ID | 54935 |
mRNA Refseq | NM_017823 |
Protein Refseq | NP_060293 |
UniProt ID | Q9BVJ7 |
◆ Recombinant Proteins | ||
DUSP23-4885M | Recombinant Mouse DUSP23 Protein | +Inquiry |
DUSP23-2936H | Recombinant Human DUSP23 Protein, GST-tagged | +Inquiry |
Dusp23-2687M | Recombinant Mouse Dusp23 Protein, Myc/DDK-tagged | +Inquiry |
DUSP23-2568M | Recombinant Mouse DUSP23 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP23-12214H | Recombinant Human DUSP23, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP23-6776HCL | Recombinant Human DUSP23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP23 Products
Required fields are marked with *
My Review for All DUSP23 Products
Required fields are marked with *