Recombinant Human DUSP23 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DUSP23-2750H |
Product Overview : | DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14). |
Molecular Mass : | 16.6 kDa |
AA Sequence : | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DUSP23 dual specificity phosphatase 23 [ Homo sapiens (human) ] |
Official Symbol | DUSP23 |
Synonyms | DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; VH1-like member Z; VH1-like phosphatase Z; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; VHZ; MOSP; LDP-3; RP11-190A12.1; |
Gene ID | 54935 |
mRNA Refseq | NM_017823 |
Protein Refseq | NP_060293 |
MIM | 618361 |
UniProt ID | Q9BVJ7 |
◆ Recombinant Proteins | ||
DUSP23-1538H | Recombinant Human Dual Specificity Phosphatase 23, His-tagged | +Inquiry |
DUSP23-2750H | Recombinant Human DUSP23 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP23-4106HF | Recombinant Full Length Human DUSP23 Protein, GST-tagged | +Inquiry |
DUSP23-2936H | Recombinant Human DUSP23 Protein, GST-tagged | +Inquiry |
DUSP23-12214H | Recombinant Human DUSP23, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP23-6776HCL | Recombinant Human DUSP23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP23 Products
Required fields are marked with *
My Review for All DUSP23 Products
Required fields are marked with *
0
Inquiry Basket