Recombinant Human DUSP26, His-tagged DUSP26-26910TH

Recombinant Human DUSP26, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DUSP26, His-tagged

Recombinant Human DUSP26, His-tagged

DUSP26 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DUSP26-26910TH
Product Overview : Recombinant fragment, corresponding to amino acids 29-211 of Human DUSP26 with N terminal His tag; 183 amino acids, 21kDa.
Conjugation : HIS
Source : E. coli
Tissue specificity : Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Form : Lyophilised:Reconstitute with 144 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPG LYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAY EGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQP GGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKD HRGIIPNRGFLRQLLALDRRLRQGLEA
Sequence Similarities : Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.
Gene Name : DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ]
Official Symbol : DUSP26
Synonyms : DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136;
Gene ID : 78986
mRNA Refseq : NM_024025
Protein Refseq : NP_076930
Uniprot ID : Q9BV47
Chromosome Location : 8p12
Function : hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy