"ECH1" Related Products

Expand
Expand

Recombinant Human ECH1, His-tagged

Cat.No.: ECH1-28224TH
Product Overview: Recombinant full length Human ECH1, amino acids 34-328 with N terminal His tag; 316 amino acids with a predicted MWt 34.4 kDa including tag.
Description: This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Protein length: 295 amino acids
Conjugation: HIS
Molecular Weight: 34.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Sequence Similarities: Belongs to the enoyl-CoA hydratase/isomerase family.
Gene Name: ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ]
Official Symbol: ECH1
Synonyms: ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL;
Gene ID: 1891
mRNA Refseq: NM_001398
Protein Refseq: NP_001389
MIM: 600696
Uniprot ID: Q13011
Chromosome Location: 19q13.1
Pathway: Fatty Acid Biosynthesis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem;
Function: enoyl-CoA hydratase activity; isomerase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.