Recombinant Human ECH1, His-tagged ECH1-28224TH

Specification
Gene Information
Related Products

Cat.No.:	ECH1-28224TH
Product Overview:	Recombinant full length Human ECH1, amino acids 34-328 with N terminal His tag; 316 amino acids with a predicted MWt 34.4 kDa including tag.
Description:	This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Protein length:	295 amino acids
Conjugation:	HIS
Molecular Weight:	34.400kDa inclusive of tags
Source:	E. coli
Form:	Liquid
Purity:	>90% by SDS-PAGE
Storage buffer:	Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage:	Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids:	MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Sequence Similarities:	Belongs to the enoyl-CoA hydratase/isomerase family.

Download Datasheet

Gene Name:	ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ]
Official Symbol:	ECH1
Synonyms:	ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL;
Gene ID:	1891
mRNA Refseq:	NM_001398
Protein Refseq:	NP_001389
MIM:	600696
Uniprot ID:	Q13011
Chromosome Location:	19q13.1
Pathway:	Fatty Acid Biosynthesis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem;
Function:	enoyl-CoA hydratase activity; isomerase activity; protein binding;