Recombinant Human ECH1, His-tagged

Cat.No. : ECH1-28224TH
Product Overview : Recombinant full length Human ECH1, amino acids 34-328 with N terminal His tag; 316 amino acids with a predicted MWt 34.4 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 295 amino acids
Description : This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
Conjugation : HIS
Molecular Weight : 34.400kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Sequence Similarities : Belongs to the enoyl-CoA hydratase/isomerase family.
Gene Name ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ]
Official Symbol ECH1
Synonyms ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL;
Gene ID 1891
mRNA Refseq NM_001398
Protein Refseq NP_001389
MIM 600696
Uniprot ID Q13011
Chromosome Location 19q13.1
Pathway Fatty Acid Biosynthesis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem;
Function enoyl-CoA hydratase activity; isomerase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECH1 Products

Required fields are marked with *

My Review for All ECH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon