Recombinant Human ECH1 Protein, GST-tagged
Cat.No. : | ECH1-3030H |
Product Overview : | Human ECH1 full-length ORF ( NP_001389.2, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ] |
Official Symbol | ECH1 |
Synonyms | ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL; dienoyl-CoA isomerase; peroxisomal enoyl-CoA hydratase 1; delta3,5-delta2,4-dienoyl-CoA isomerase; |
Gene ID | 1891 |
mRNA Refseq | NM_001398 |
Protein Refseq | NP_001389 |
MIM | 600696 |
UniProt ID | Q13011 |
◆ Recombinant Proteins | ||
ECH1-2621M | Recombinant Mouse ECH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECH1-4965M | Recombinant Mouse ECH1 Protein | +Inquiry |
ECH1-1658R | Recombinant Rat ECH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECH1-28224TH | Recombinant Human ECH1, His-tagged | +Inquiry |
ECH1-3030H | Recombinant Human ECH1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECH1-6730HCL | Recombinant Human ECH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECH1 Products
Required fields are marked with *
My Review for All ECH1 Products
Required fields are marked with *