Recombinant Full Length Human ECH1 Protein, GST-tagged

Cat.No. : ECH1-4161HF
Product Overview : Human ECH1 full-length ORF ( NP_001389.2, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 328 amino acids
Description : This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq, Jul 2008]
Molecular Mass : 62.2 kDa
AA Sequence : MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ]
Official Symbol ECH1
Synonyms ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL; dienoyl-CoA isomerase; peroxisomal enoyl-CoA hydratase 1; delta3,5-delta2,4-dienoyl-CoA isomerase;
Gene ID 1891
mRNA Refseq NM_001398
Protein Refseq NP_001389
MIM 600696
UniProt ID Q13011

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECH1 Products

Required fields are marked with *

My Review for All ECH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon