"EFNA2" Related Products

Expand
Expand

Recombinant Human EFNA2

Cat.No.: EFNA2-28624TH
Product Overview: Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa.
Description: This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Protein length: 213 amino acids
Molecular Weight: 50.430kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
Sequence Similarities: Belongs to the ephrin family.
Gene Name: EFNA2 ephrin-A2 [ Homo sapiens ]
Official Symbol: EFNA2
Synonyms: EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6;
Gene ID: 1943
mRNA Refseq: NM_001405
Protein Refseq: NP_001396
MIM: 602756
Uniprot ID: O43921
Chromosome Location: 19p13
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem;
Function: ephrin receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.