Recombinant Human EIF1AY, His-tagged

• Cat.No.: EIF1AY-28548TH
• Product Overview: Recombinant full length Human EIF1AY with N terminal His tag; 167 amino acids with tag; MWt 18.8 kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 144 amino acids
• Description: This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5 end of capped RNA.
• Conjugation: HIS
• Molecular Weight: 18.800kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
• Sequence Similarities: Belongs to the eIF-1A family.Contains 1 S1-like domain.

Gene Information

• Gene Name: EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ]
• Official Symbol: EIF1AY
• Synonyms: EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal
• Gene ID: 9086
• mRNA Refseq: NM_004681
• Protein Refseq: NP_004672
• MIM: 400014
• Uniprot ID: O14602
• Chromosome Location: Y
• Pathway: RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Translation Factors, organism-specific biosystem
• Function: RNA binding; protein binding; translation initiation factor activity