Recombinant Human EIF1AY, His-tagged

Cat.No. : EIF1AY-28548TH
Product Overview : Recombinant full length Human EIF1AY with N terminal His tag; 167 amino acids with tag; MWt 18.8 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 144 amino acids
Description : This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5 end of capped RNA.
Conjugation : HIS
Molecular Weight : 18.800kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Sequence Similarities : Belongs to the eIF-1A family.Contains 1 S1-like domain.
Gene Name EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ]
Official Symbol EIF1AY
Synonyms EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal;
Gene ID 9086
mRNA Refseq NM_004681
Protein Refseq NP_004672
MIM 400014
Uniprot ID O14602
Chromosome Location Y
Pathway RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Translation Factors, organism-specific biosystem;
Function RNA binding; protein binding; translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF1AY Products

Required fields are marked with *

My Review for All EIF1AY Products

Required fields are marked with *

0
cart-icon
0
compare icon