Recombinant Full Length Human EIF1AY Protein, GST-tagged

Cat.No. : EIF1AY-4405HF
Product Overview : Human EIF1AY full-length ORF ( AAH05248, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Molecular Mass : 41.47 kDa
AA Sequence : MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ]
Official Symbol EIF1AY
Synonyms EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; eIF-4C; eIF-1A Y isoform; eukaryotic translation initiation factor 4C;
Gene ID 9086
mRNA Refseq NM_004681
Protein Refseq NP_004672
MIM 400014
UniProt ID O14602

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF1AY Products

Required fields are marked with *

My Review for All EIF1AY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon