Recombinant Full Length Human EIF1AY Protein, GST-tagged
Cat.No. : | EIF1AY-4405HF |
Product Overview : | Human EIF1AY full-length ORF ( AAH05248, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 144 amino acids |
Description : | This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 41.47 kDa |
AA Sequence : | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ] |
Official Symbol | EIF1AY |
Synonyms | EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; eIF-4C; eIF-1A Y isoform; eukaryotic translation initiation factor 4C; |
Gene ID | 9086 |
mRNA Refseq | NM_004681 |
Protein Refseq | NP_004672 |
MIM | 400014 |
UniProt ID | O14602 |
◆ Recombinant Proteins | ||
EIF1AY-3418H | Recombinant Human EIF1AY, His-tagged | +Inquiry |
EIF1AY-28548TH | Recombinant Human EIF1AY, His-tagged | +Inquiry |
EIF1AY-4405HF | Recombinant Full Length Human EIF1AY Protein, GST-tagged | +Inquiry |
EIF1AY-3142H | Recombinant Human EIF1AY Protein, GST-tagged | +Inquiry |
EIF1AY-12346H | Recombinant Human EIF1AY, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1AY-6676HCL | Recombinant Human EIF1AY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF1AY Products
Required fields are marked with *
My Review for All EIF1AY Products
Required fields are marked with *