Recombinant Human EIF1AY, His-tagged
Cat.No. : | EIF1AY-28548TH |
Product Overview : | Recombinant full length Human EIF1AY with N terminal His tag; 167 amino acids with tag; MWt 18.8 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 144 amino acids |
Description : | This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A). EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5 end of capped RNA. |
Conjugation : | HIS |
Molecular Weight : | 18.800kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Sequence Similarities : | Belongs to the eIF-1A family.Contains 1 S1-like domain. |
Gene Name | EIF1AY eukaryotic translation initiation factor 1A, Y-linked [ Homo sapiens ] |
Official Symbol | EIF1AY |
Synonyms | EIF1AY; eukaryotic translation initiation factor 1A, Y-linked; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; |
Gene ID | 9086 |
mRNA Refseq | NM_004681 |
Protein Refseq | NP_004672 |
MIM | 400014 |
Uniprot ID | O14602 |
Chromosome Location | Y |
Pathway | RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Translation Factors, organism-specific biosystem; |
Function | RNA binding; protein binding; translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF1AY-2502C | Recombinant Chicken EIF1AY | +Inquiry |
EIF1AY-12346H | Recombinant Human EIF1AY, GST-tagged | +Inquiry |
EIF1AY-3418H | Recombinant Human EIF1AY, His-tagged | +Inquiry |
EIF1AY-1237R | Recombinant Rhesus Macaque EIF1AY Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1AY-28548TH | Recombinant Human EIF1AY, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1AY-6676HCL | Recombinant Human EIF1AY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF1AY Products
Required fields are marked with *
My Review for All EIF1AY Products
Required fields are marked with *