"EIF2B3" Related Products

Expand
Expand
Expand

Recombinant Human EIF2B3, His-tagged

Cat.No.: EIF2B3-28491TH
Product Overview: Recombinant fragment, corresponding to amino acids 167-452 of Human eIF2B3 with an N terminal His tag. Predicted MWt: 33 kDa;
Description: The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 66 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYC LKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQ GQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACW NACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEA NRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTV EEGSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence Similarities: Belongs to the eIF-2B gamma/epsilon subunits family.
Gene Name: EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ]
Official Symbol: EIF2B3
Synonyms: EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma;
Gene ID: 8891
mRNA Refseq: NM_020365
Protein Refseq: NP_065098
MIM: 606273
Uniprot ID: Q9NR50
Chromosome Location: 1p34.1
Pathway: Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem;
Function: contributes_to guanyl-nucleotide exchange factor activity; contributes_to guanyl-nucleotide exchange factor activity; nucleotidyltransferase activity; protein binding; contributes_to translation factor activity, nucleic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.