Recombinant Human ELF5

Cat.No. : ELF5-28286TH
Product Overview : Recombinant fragment of Human ELF5 with N terminal proprietary tag. Predicted MW 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tiss
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
Sequence Similarities : Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain.
Gene Name ELF5 E74-like factor 5 (ets domain transcription factor) [ Homo sapiens ]
Official Symbol ELF5
Synonyms ELF5; E74-like factor 5 (ets domain transcription factor); ETS-related transcription factor Elf-5;
Gene ID 2001
mRNA Refseq NM_001243080
Protein Refseq NP_001230009
MIM 605169
Uniprot ID Q9UKW6
Chromosome Location 11p13-p12
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELF5 Products

Required fields are marked with *

My Review for All ELF5 Products

Required fields are marked with *

0
cart-icon