"EPAS1" Related Products

Expand
Expand
Expand

Recombinant Human EPAS1

Cat.No.: EPAS1-29318TH
Product Overview: Recombinant fragment (amino acids 28-347) of Human HIF2 alpha with proprietary tag at the N terminal; Predicted MW 60.83 kDa, inclusive of tag.
Description: This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4.
Protein length: 320 amino acids
Molecular Weight: 60.830kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTH KLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGD MIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENL SLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKS ATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCE PIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGY HPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQY RMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEI
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
Gene Name: EPAS1 endothelial PAS domain protein 1 [ Homo sapiens ]
Official Symbol: EPAS1
Synonyms: EPAS1; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; bHLHe73; HIF 1 alpha like factor; HIF2A; HLF; MOP2; PASD2;
Gene ID: 2034
mRNA Refseq: NM_001430
Protein Refseq: NP_001421
MIM: 603349
Uniprot ID: Q99814
Chromosome Location: 2p21-p16
Pathway: Adipogenesis, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem;
Function: DNA binding; histone acetyltransferase binding; protein binding; protein heterodimerization activity; contributes_to sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.