Recombinant Human EPAS1
Cat.No. : | EPAS1-29318TH |
Product Overview : | Recombinant fragment (amino acids 28-347) of Human HIF2 alpha with proprietary tag at the N terminal; Predicted MW 60.83 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 320 amino acids |
Description : | This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4. |
Molecular Weight : | 60.830kDa inclusive of tags |
Tissue specificity : | Expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTH KLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGD MIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENL SLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKS ATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCE PIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGY HPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQY RMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEI |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains. |
Gene Name | EPAS1 endothelial PAS domain protein 1 [ Homo sapiens ] |
Official Symbol | EPAS1 |
Synonyms | EPAS1; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; bHLHe73; HIF 1 alpha like factor; HIF2A; HLF; MOP2; PASD2; |
Gene ID | 2034 |
mRNA Refseq | NM_001430 |
Protein Refseq | NP_001421 |
MIM | 603349 |
Uniprot ID | Q99814 |
Chromosome Location | 2p21-p16 |
Pathway | Adipogenesis, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem; |
Function | DNA binding; histone acetyltransferase binding; protein binding; protein heterodimerization activity; contributes_to sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
Epas1-8055R | Recombinant Rat Epas1 protein, His-tagged | +Inquiry |
Epas1-151M | Recombinant Mouse Epas1 protein, His/S-tagged | +Inquiry |
EPAS1-2967H | Recombinant Human EPAS1 Protein (Leu239-Asn350), N-His tagged | +Inquiry |
EPAS1-0330H | Recombinant Human EPAS1 Protein (Ala34-Ser392), C-His-tagged | +Inquiry |
EPAS1-6370C | Recombinant Chicken EPAS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPAS1-6588HCL | Recombinant Human EPAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPAS1 Products
Required fields are marked with *
My Review for All EPAS1 Products
Required fields are marked with *
0
Inquiry Basket