"ETFA" Related Products

Expand

Recombinant Human ETFA, His-tagged

Cat.No.: ETFA-28858TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-284 of Human MADD with N terminal His Tag; Predicted MWt 31 kDa.
Description: ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MFRAAAPGQLRRAVAQDLCKVAGIAKVLVAQHDVYKGLLP EELTPLILATQKQFNYTHICAGASAFGKNLLPRVAAKL EVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKV FSVRGTSFDAAATSGGSASSEKASSTSPVEISEWLDQKLT KSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHA AVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGIS GAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADL FKVVPEMTEILKKK
Sequence Similarities: Belongs to the ETF alpha-subunit/fixB family.
Gene Name: ETFA electron-transfer-flavoprotein, alpha polypeptide [ Homo sapiens ]
Official Symbol: ETFA
Synonyms: ETFA; electron-transfer-flavoprotein, alpha polypeptide; electron transfer flavoprotein subunit alpha, mitochondrial; EMA; GA2; glutaric aciduria II; MADD;
Gene ID: 2108
mRNA Refseq: NM_000126
Protein Refseq: NP_000117
MIM: 608053
Uniprot ID: P13804
Chromosome Location: 15q23-q25
Pathway: Metabolism, organism-specific biosystem; Respiratory electron transport, organism-specific biosystem; Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins., organism-specific biosystem; The citric acid (TCA) cycle and respiratory electron transport, organism-specific biosystem;
Function: electron carrier activity; flavin adenine dinucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.