"FANCG" Related Products

Expand
Expand

Recombinant Human FANCG

Cat.No.: FANCG-28822TH
Product Overview: Recombinant full length Human FANCG with a N terminal proprietary tag; Predicted MWt 94.53 kDa including the tag.
Description: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group G.
Protein length: 622 amino acids
Molecular Weight: 94.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in testis and thymus. Found in lymphoblasts.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLR RQQLAQDALEGLRGLLHSLQGLPAAVPVLPLELTVTCNFI ILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGL RELWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGD LALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQ DAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASG LCPRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSA WGPPLLEASRLYQQLGDTTAELESLELLVEALNVPCSSKA PQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTG RAGDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFL EAAVALIQAGRAQDALTLCEELLSRTSSLLPKMSRLWEDA RKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSR CLELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALI SRGLEWVASGQDTKALQDFLLSVQMCPGNRDTYFHLLQTL KRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLS WIRPSDRDAFLEEFRTSLPKSCDL
Sequence Similarities: Contains 4 TPR repeats.
Gene Name: FANCG Fanconi anemia, complementation group G [ Homo sapiens ]
Official Symbol: FANCG
Synonyms: FANCG; Fanconi anemia, complementation group G; XRCC9; Fanconi anemia group G protein; DNA repair protein XRCC9; FAG; X ray repair complementing defective repair in Chinese hamster cells 9; X ray repair; complementing defective; in Chinese hamster; 9;
Gene ID: 2189
mRNA Refseq: NM_004629
Protein Refseq: NP_004620
MIM: 602956
Uniprot ID: O15287
Chromosome Location: 9p13
Pathway: BARD1 signaling events, organism-specific biosystem; DNA Repair, organism-specific biosystem; FA core complex, organism-specific biosystem; Fanconi Anemia pathway, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function: damaged DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.