Recombinant Human FBLN1
Cat.No. : | FBLN1-28901TH |
Product Overview : | Recombinant fragment corresponding to amino acids 151-250 of Human Fibulin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3 end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT |
Sequence Similarities : | Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 9 EGF-like domains. |
Gene Name | FBLN1 fibulin 1 [ Homo sapiens ] |
Official Symbol | FBLN1 |
Synonyms | FBLN1; fibulin 1; fibulin-1; FBLN; |
Gene ID | 2192 |
mRNA Refseq | NM_001996 |
Protein Refseq | NP_001987 |
MIM | 135820 |
Uniprot ID | P23142 |
Chromosome Location | 22q13.31 |
Function | calcium ion binding; extracellular matrix structural constituent; peptidase activator activity; |
◆ Recombinant Proteins | ||
Fbln1-724M | Recombinant Mouse Fbln1 Protein, His-tagged | +Inquiry |
FBLN1-2429H | Recombinant Human FBLN1 Protein (30-703 aa), His-Myc-tagged | +Inquiry |
FBLN1-723H | Recombinant Human FBLN1 Protein, His-tagged | +Inquiry |
FBLN1-1464H | Recombinant Human FBLN1 Protein, His-tagged | +Inquiry |
FBLN1-5740C | Recombinant Chicken FBLN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBLN1-598HCL | Recombinant Human FBLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBLN1 Products
Required fields are marked with *
My Review for All FBLN1 Products
Required fields are marked with *