Recombinant Human FBLN1

Cat.No. : FBLN1-28901TH
Product Overview : Recombinant fragment corresponding to amino acids 151-250 of Human Fibulin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3 end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT
Sequence Similarities : Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 9 EGF-like domains.
Gene Name FBLN1 fibulin 1 [ Homo sapiens ]
Official Symbol FBLN1
Synonyms FBLN1; fibulin 1; fibulin-1; FBLN;
Gene ID 2192
mRNA Refseq NM_001996
Protein Refseq NP_001987
MIM 135820
Uniprot ID P23142
Chromosome Location 22q13.31
Function calcium ion binding; extracellular matrix structural constituent; peptidase activator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBLN1 Products

Required fields are marked with *

My Review for All FBLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon