Recombinant Human FBLN1
| Cat.No. : | FBLN1-28901TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 151-250 of Human Fibulin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3 end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Isoform A and isoform B are only expressed in placenta. Isoform C and isoform D are expressed in a variety of tissues and cultured cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT |
| Sequence Similarities : | Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 9 EGF-like domains. |
| Gene Name | FBLN1 fibulin 1 [ Homo sapiens ] |
| Official Symbol | FBLN1 |
| Synonyms | FBLN1; fibulin 1; fibulin-1; FBLN; |
| Gene ID | 2192 |
| mRNA Refseq | NM_001996 |
| Protein Refseq | NP_001987 |
| MIM | 135820 |
| Uniprot ID | P23142 |
| Chromosome Location | 22q13.31 |
| Function | calcium ion binding; extracellular matrix structural constituent; peptidase activator activity; |
| ◆ Recombinant Proteins | ||
| FBLN1-16H | Recombinant Human FBLN1 protein, MYC/DDK-tagged | +Inquiry |
| FBLN1-01H | Active Recombinant Human FBLN1 Protein, HA-tagged | +Inquiry |
| FBLN1-8670Z | Recombinant Zebrafish FBLN1 | +Inquiry |
| Fbln1-725R | Recombinant Rat Fbln1 Protein, His-tagged | +Inquiry |
| FBLN1-4880HF | Recombinant Full Length Human FBLN1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FBLN1-598HCL | Recombinant Human FBLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FBLN1 Products
Required fields are marked with *
My Review for All FBLN1 Products
Required fields are marked with *
