Recombinant Human FBN1

Cat.No. : FBN1-28892TH
Product Overview : Recombinant fragment corresponding to amino acids 2772-2871 of Human Fibrillin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the fibrillin family. The encoded protein is a large, extracellular matrix glycoprotein that serve as a structural component of 10-12 nm calcium-binding microfibrils. These microfibrils provide force bearing structural support in elastic and nonelastic connective tissue throughout the body. Mutations in this gene are associated with Marfan syndrome, isolated ectopia lentis, autosomal dominant Weill-Marchesani syndrome, MASS syndrome, and Shprintzen-Goldberg craniosynostosis syndrome.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Sequence Similarities : Belongs to the fibrillin family.Contains 47 EGF-like domains.Contains 9 TB (TGF-beta binding) domains.
Gene Name FBN1 fibrillin 1 [ Homo sapiens ]
Official Symbol FBN1
Synonyms FBN1; fibrillin 1; FBN, fibrillin 1 (Marfan syndrome) , MFS1, WMS; fibrillin-1; Marfan syndrome; MASS; OCTD; SGS;
Gene ID 2200
mRNA Refseq NM_000138
Protein Refseq NP_000129
MIM 134797
Uniprot ID P35555
Chromosome Location 15q21.1
Pathway Integrin cell surface interactions, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function calcium ion binding; extracellular matrix structural constituent; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FBN1 Products

Required fields are marked with *

My Review for All FBN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon