Recombinant Human FBXW4, His-tagged FBXW4-30064TH

Recombinant Human FBXW4, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FBXW4, His-tagged

Recombinant Human FBXW4, His-tagged

FBXW4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FBXW4-30064TH
Product Overview : Recombinant fragment, corresponding to amino acids 65-394 of Human SHFM3 with an N terminal His tag. Predicted mwt: 38 kDa.
Description : This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in brain, kidney, lung and liver.
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLLWRRIARASLNSGFTRLGTDLMTSVPVKERVKVSQNWR LGRCREGILLKWRCSQMPWMQLEDDSLYISQANFILAY QFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAG GDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSG SRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGV LDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEE PHDSTLYCLQTDGNHLLATGSSYYGVVRLWDRRQRACL HAFPLTSTPLSSPVYCLRLTTK
Sequence Similarities : Contains 1 F-box domain.Contains 4 WD repeats.
Gene Name : FBXW4 F-box and WD repeat domain containing 4 [ Homo sapiens ]
Official Symbol : FBXW4
Synonyms : FBXW4; F-box and WD repeat domain containing 4; F box and WD 40 domain protein 4 , SHFM3, split hand/foot malformation (ectrodactyly) type 3; F-box/WD repeat-containing protein 4; dactylin; Fbw4;
Gene ID : 6468
mRNA Refseq : NM_022039
Protein Refseq : NP_071322
MIM : 608071
Uniprot ID : P57775
Chromosome Location : 10q24
Pathway : Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function : molecular_function;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy