Recombinant Human FDPS

Cat.No. : FDPS-28480TH
Product Overview : Recombinant fragment corresponding to amino acids 320-419 of Human FDPS with N terminal proprietary tag; predicted MW: 36.63 kDa, inclusive of tag. P14324,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Sequence Similarities : Belongs to the FPP/GGPP synthase family.
Gene Name FDPS farnesyl diphosphate synthase [ Homo sapiens ]
Official Symbol FDPS
Synonyms FDPS; farnesyl diphosphate synthase; farnesyl pyrophosphate synthase; farnesyl pyrophosphate synthetase; dimethylallyltranstransferase; geranyltranstransferase;
Gene ID 2224
mRNA Refseq NM_001135821
Protein Refseq NP_001129293
MIM 134629
Uniprot ID P14324
Chromosome Location 1q22
Pathway Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Influenza A, organism-specific biosystem;
Function dimethylallyltranstransferase activity; geranyltranstransferase activity; metal ion binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FDPS Products

Required fields are marked with *

My Review for All FDPS Products

Required fields are marked with *

0
cart-icon
0
compare icon