"FOXK2" Related Products

Recombinant Human FOXK2

Cat.No.: FOXK2-29031TH
Product Overview: Recombinant fragment of Human ILF1 with N terminal proprietary tag, predicted MWt 36.63 kDa.
Description: The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in both lymphoid and non-lymphoid cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
Sequence Similarities: Contains 1 FHA domain.Contains 1 fork-head DNA-binding domain.
Gene Name: FOXK2 forkhead box K2 [ Homo sapiens ]
Official Symbol: FOXK2
Synonyms: FOXK2; forkhead box K2; ILF, ILF1, interleukin enhancer binding factor 1; forkhead box protein K2;
Gene ID: 3607
mRNA Refseq: NM_004514
Protein Refseq: NP_004505
MIM: 147685
Uniprot ID: Q01167
Chromosome Location: 17q25
Function: DNA bending activity; double-stranded DNA binding; magnesium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.