"FUCA1" Related Products

Expand
Expand

Recombinant Human FUCA1

Cat.No.: FUCA1-28956TH
Product Overview: Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag. P04066,
Description: The protein encoded by this gene is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. Mutations in this gene are associated with fucosidosis (FUCA1D), which is an autosomal recessive lysosomal storage disease. A pseudogene of this locus is present on chr 2.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
Sequence Similarities: Belongs to the glycosyl hydrolase 29 family.
Gene Name: FUCA1 fucosidase, alpha-L- 1, tissue [ Homo sapiens ]
Official Symbol: FUCA1
Synonyms: FUCA1; fucosidase, alpha-L- 1, tissue; tissue alpha-L-fucosidase;
Gene ID: 2517
mRNA Refseq: NM_000147
Protein Refseq: NP_000138
MIM: 612280
Uniprot ID: P04066
Chromosome Location: 1p34
Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem;
Function: alpha-L-fucosidase activity; cation binding; hydrolase activity, acting on glycosyl bonds; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.