Recombinant Human FUCA2 FUCA2-28957TH

Recombinant Human FUCA2

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FUCA2

Recombinant Human FUCA2

FUCA2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FUCA2-28957TH
Product Overview : Recombinant full length Human FUCA2 with N-terminal proprietary tag. Predicted MW 77.44 kDa.
Description : This gene encodes a plasma alpha-L-fucosidase, which represents 10-20% of the total cellular fucosidase activity. The protein is a member of the glycosyl hydrolase 29 family, and catalyzes the hydrolysis of the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. This enzyme is essential for Helicobacter pylori adhesion to human gastric cancer cells.
Protein length : 467 amino acids
Molecular Weight : 77.440kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWES LDARQLPAWFDQAKFGIFIHWGVFSVPSFGSEWFWWYWQK EKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADI FQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRD IVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFH KRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNS TGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDR YNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELV KQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQVGSWL KVNGEAIYETYTWRSQNDTVTPDVWYTSKPKEKLVYAIFL KWPTSGQLFLGHPKAILGATEVKLLGHGQPLNWISLEQNG IMVELPQLTIHQMPCKWGWALALTNVI
Sequence Similarities : Belongs to the glycosyl hydrolase 29 family.
Gene Name : FUCA2 fucosidase, alpha-L- 2, plasma [ Homo sapiens ]
Official Symbol : FUCA2
Synonyms : FUCA2; fucosidase, alpha-L- 2, plasma; plasma alpha-L-fucosidase; dJ20N2.5; MGC1314;
Gene ID : 2519
mRNA Refseq : NM_032020
Protein Refseq : NP_114409
MIM : 136820
Uniprot ID : Q9BTY2
Chromosome Location : 6q24
Pathway : Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem;
Function : alpha-L-fucosidase activity; catalytic activity; cation binding; hydrolase activity, acting on glycosyl bonds;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy