Recombinant Human FUS, His-tagged

• Cat.No.: FUS-30143TH
• Product Overview: Recombinant fragment, corresponding to amino acids 262-526 of Human TLS/FUS with an N-terminal His tag; Predicted MWt 29 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 262-526 a.a.
• Description: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
• Conjugation: HIS
• Tissue specificity: Ubiquitous.
• Form: Lyophilised:Reconstitute with 106 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATV SFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR GGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGG GGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGG FRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
• Sequence Similarities: Belongs to the RRM TET family.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.

Gene Information

• Gene Name: FUS fused in sarcoma [ Homo sapiens ]
• Official Symbol: FUS
• Synonyms: FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRN
• Gene ID: 2521
• mRNA Refseq: NM_001170634
• Protein Refseq: NP_001164105
• MIM: 137070
• Uniprot ID: P35637
• Chromosome Location: 16p11.2
• Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: DNA binding; RNA binding; metal ion binding; nucleotide binding; protein binding