Recombinant Human FUS, His-tagged FUS-30143TH

Recombinant Human FUS, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FUS, His-tagged

Recombinant Human FUS, His-tagged

FUS Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FUS-30143TH
Product Overview : Recombinant fragment, corresponding to amino acids 262-526 of Human TLS/FUS with an N-terminal His tag; Predicted MWt 29 kDa.
Description : This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 106 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATV SFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR GGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGG GGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGG FRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Sequence Similarities : Belongs to the RRM TET family.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.
Gene Name : FUS fused in sarcoma [ Homo sapiens ]
Official Symbol : FUS
Synonyms : FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRN
Gene ID : 2521
mRNA Refseq : NM_001170634
Protein Refseq : NP_001164105
MIM : 137070
Uniprot ID : P35637
Chromosome Location : 16p11.2
Pathway : Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function : DNA binding; RNA binding; metal ion binding; nucleotide binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy