"FUS" Related Products

Expand
Expand
Expand

Recombinant Human FUS, His-tagged

Cat.No.: FUS-30143TH
Product Overview: Recombinant fragment, corresponding to amino acids 262-526 of Human TLS/FUS with an N-terminal His tag; Predicted MWt 29 kDa.
Description: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 106 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESV ADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATV SFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR GGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGG GGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGG FRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Sequence Similarities: Belongs to the RRM TET family.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.
Gene Name: FUS fused in sarcoma [ Homo sapiens ]
Official Symbol: FUS
Synonyms: FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRN
Gene ID: 2521
mRNA Refseq: NM_001170634
Protein Refseq: NP_001164105
MIM: 137070
Uniprot ID: P35637
Chromosome Location: 16p11.2
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: DNA binding; RNA binding; metal ion binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.