Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GABRB3

Cat.No. : GABRB3-28089TH
Product Overview : Recombinant fragment corresponding to amino acids 26-135 of Human GABA A Receptor beta 3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two genes encoding related subunits of the family. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGM NIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN LTLDNRVADQLWVPDTYFLNDKKSFVHGVT
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily. GABRB3 sub-subfamily.
Gene Name : GABRB3 gamma-aminobutyric acid (GABA) A receptor, beta 3 [ Homo sapiens ]
Official Symbol : GABRB3
Synonyms : GABRB3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid receptor subunit beta-3;
Gene ID : 2562
mRNA Refseq : NM_021912
Protein Refseq : NP_068712
Uniprot ID : P28472
Chromosome Location : 15q11.2-q12
Pathway : GABA A receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Ion channel transport, organism-specific biosystem;
Function : GABA-A receptor activity; chloride channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How is GABRB3 linked to autism and epilepsy? 09/05/2022

Mutations and altered GABRB3 expression increase risk for autism and certain epilepsies.

What is GABRB3's primary function in the central nervous system? 04/24/2022

GABRB3 is essential for inhibitory neurotransmission as part of the GABA-A receptor.

How does GABRB3 expression vary with development? 03/14/2022

GABRB3 shows higher expression in early development, varying across stages.

What effects does GABRB3 gene knockout have in animal models? 01/03/2022

GABRB3 knockout results in behavioral abnormalities and synaptic changes.

What post-translational modifications occur on GABRB3? 11/14/2019

GABRB3 undergoes phosphorylation, impacting receptor activity.

What are GABRB3's potential therapeutic applications? 08/27/2019

Targeting GABRB3 may benefit disorders related to GABAergic dysfunction, like epilepsy and anxiety.

Can you list GABRB3's known interacting partners? 02/27/2019

GABRB3 interacts with other GABA-A receptor subunits for proper function.

Customer Reviews (3)

Write a review
Reviews
05/04/2019

    Would definitely recommend.

    08/27/2018

      Easy to work with.

      02/22/2018

        Fantastic product, very happy.

        Ask a Question for All GABRB3 Products

        Required fields are marked with *

        My Review for All GABRB3 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends