"GAD1" Related Products

Expand
Expand
Expand

Recombinant Human GAD1

Cat.No.: GAD1-26511TH
Product Overview: Recombinant full length Human GAD1 protein with a N terminal proprietary tag: predicted molecular weight 91.08 kDa.
Description: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.
Protein length: 594 amino acids
Molecular Weight: 91.080kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCT RKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCE NSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSD HPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL AGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVP KLVLFTSEQSHYSIKKAGAALGFGTDNVILIKCNERGKII PADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVT WNPHKMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDK QYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQ SLRGVPDSPQRREKLHKVAPKIKALMMESGTTMVGYQPQG DKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Sequence Similarities: Belongs to the group II decarboxylase family.
Gene Name: GAD1 glutamate decarboxylase 1 (brain, 67kDa) [ Homo sapiens ]
Official Symbol: GAD1
Synonyms: GAD1; glutamate decarboxylase 1 (brain, 67kDa); GAD, glutamate decarboxylase 1 (brain, 67kD); glutamate decarboxylase 1;
Gene ID: 2571
mRNA Refseq: NM_000817
Protein Refseq: NP_000808
MIM: 605363
Uniprot ID: Q99259
Chromosome Location: 2q31
Pathway: Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Butanoate metabolism, organism-specific biosystem;
Function: carboxy-lyase activity; glutamate decarboxylase activity; lyase activity; protein binding; pyridoxal phosphate binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.