"GALT" Related Products

Expand
Expand

Recombinant Human GALT, His-tagged

Cat.No.: GALT-27306TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-313 of Human GALT with N terminal His tag; 313 amino acids, 36kDa.
Description: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDE WVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGA IRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWAS VTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSF LPDIAQREERSQQAYKSQHGEPLLMEYSRQELLRKERLVL TSEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAER DDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAG ANW
Sequence Similarities: Belongs to the galactose-1-phosphate uridylyltransferase type 1 family.
Gene Name: GALT galactose-1-phosphate uridylyltransferase [ Homo sapiens ]
Official Symbol: GALT
Synonyms: GALT; galactose-1-phosphate uridylyltransferase;
Gene ID: 2592
mRNA Refseq: NM_000155
Protein Refseq: NP_000146
MIM: 606999
Uniprot ID: P07902
Chromosome Location: 9p13
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose catabolism, organism-specific biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem;
Function: UDP-glucose:hexose-1-phosphate uridylyltransferase activity; metal ion binding; nucleotidyltransferase activity; transferase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.