Recombinant Human GALT, His-tagged
| Cat.No. : | GALT-27306TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-313 of Human GALT with N terminal His tag; 313 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-313 a.a. |
| Description : | Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet. The pathophysiology of galactosemia has not been clearly defined. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDE WVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGA IRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWAS VTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSF LPDIAQREERSQQAYKSQHGEPLLMEYSRQELLRKERLVL TSEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAER DDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAG ANW |
| Sequence Similarities : | Belongs to the galactose-1-phosphate uridylyltransferase type 1 family. |
| Gene Name | GALT galactose-1-phosphate uridylyltransferase [ Homo sapiens ] |
| Official Symbol | GALT |
| Synonyms | GALT; galactose-1-phosphate uridylyltransferase; |
| Gene ID | 2592 |
| mRNA Refseq | NM_000155 |
| Protein Refseq | NP_000146 |
| MIM | 606999 |
| Uniprot ID | P07902 |
| Chromosome Location | 9p13 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose catabolism, organism-specific biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; |
| Function | UDP-glucose:hexose-1-phosphate uridylyltransferase activity; metal ion binding; nucleotidyltransferase activity; transferase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| GALT-5107Z | Recombinant Zebrafish GALT | +Inquiry |
| GALT-2130R | Recombinant Rat GALT Protein, His (Fc)-Avi-tagged | +Inquiry |
| GALT-5374HF | Recombinant Full Length Human GALT Protein, GST-tagged | +Inquiry |
| GALT-13147H | Recombinant Human GALT, His-tagged | +Inquiry |
| GALT-27306TH | Recombinant Human GALT, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALT-6026HCL | Recombinant Human GALT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALT Products
Required fields are marked with *
My Review for All GALT Products
Required fields are marked with *
