"GAP43" Related Products

Expand
Expand
Expand

Recombinant Human GAP43

Cat.No.: GAP43-28977TH
Product Overview: Recombinant full length Human GAP43 with an N terminal proprietary tag; Predicted MWt 52.29 kDa inclusive of tag.
Description: The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length: 238 amino acids
Molecular Weight: 52.290kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQA SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Sequence Similarities: Belongs to the neuromodulin family.Contains 1 IQ domain.
Gene Name: GAP43 growth associated protein 43 [ Homo sapiens ]
Official Symbol: GAP43
Synonyms: GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1;
Gene ID: 2596
mRNA Refseq: NM_001130064
Protein Refseq: NP_001123536
MIM: 162060
Uniprot ID: P17677
Chromosome Location: 3q21-qter
Pathway: N-cadherin signaling events, organism-specific biosystem;
Function: calmodulin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.