Recombinant Human GAP43

• Cat.No.: GAP43-28977TH
• Product Overview: Recombinant full length Human GAP43 with an N terminal proprietary tag; Predicted MWt 52.29 kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Protein length: 238 amino acids
• Molecular Weight: 52.290kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQA SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEK KGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAP AKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
• Sequence Similarities: Belongs to the neuromodulin family.Contains 1 IQ domain.

Gene Information

• Gene Name: GAP43 growth associated protein 43 [ Homo sapiens ]
• Official Symbol: GAP43
• Synonyms: GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1
• Gene ID: 2596
• mRNA Refseq: NM_001130064
• Protein Refseq: NP_001123536
• MIM: 162060
• Uniprot ID: P17677
• Chromosome Location: 3q21-qter
• Pathway: N-cadherin signaling events, organism-specific biosystem
• Function: calmodulin binding; protein binding