Recombinant Human GJA4
Cat.No. : | GJA4-26253TH |
Product Overview : | Recombinant full length protein Human Connexin 37 / GJA4 with a N terminal proprietary tag: predicted molecular weight 62.70 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. |
Protein length : | 333 amino acids |
Molecular Weight : | 62.700kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLA GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVL QFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVL CKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPP SRPSSSASKKQYV |
Sequence Similarities : | Belongs to the connexin family. Alpha-type (group II) subfamily. |
Gene Name : | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] |
Official Symbol : | GJA4 |
Synonyms : | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37) , gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; |
Gene ID : | 2701 |
mRNA Refseq : | NM_002060 |
Protein Refseq : | NP_002051 |
MIM : | 121012 |
Uniprot ID : | P35212 |
Chromosome Location : | 1p35.1 |
Pathway : | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Gap junction assembly, organism-specific biosystem; Gap junction trafficking, organism-specific biosystem; Gap junction trafficking and regulation, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
GJA4-3571M | Recombinant Mouse GJA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJA4-2203R | Recombinant Rat GJA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJA4-4922H | Recombinant Human GJA4 Protein, GST-tagged | +Inquiry |
GJA4-7107C | Recombinant Chicken GJA4 | +Inquiry |
GJA4-6370M | Recombinant Mouse GJA4 Protein | +Inquiry |
◆ Lysates | ||
GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket