Recombinant Human GLE1

• Cat.No.: GLE1-29066TH
• Product Overview: Recombinant fragment corresponding to amino acids 140-240 of Human GLE1 with an N terminal proprietary tag; Predicted MWt 36.74 kDa

Specification

• Description: This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein length: 101 amino acids
• Molecular Weight: 36.740kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELK QHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLK LREAEQQRVKQAEQERLRKEE
• Sequence Similarities: Belongs to the GLE1 family.

Gene Information

• Gene Name: GLE1 GLE1 RNA export mediator homolog (yeast) [ Homo sapiens ]
• Official Symbol: GLE1
• Synonyms: GLE1; GLE1 RNA export mediator homolog (yeast); GLE1 (yeast homolog) like, RNA export mediator , GLE1 RNA export mediator (yeast) , GLE1 RNA export mediator like (yeast) , GLE1L, LCCS1, lethal congenital contracture syndrome 1; nucleoporin GLE1; hGLE1
• Gene ID: 2733
• mRNA Refseq: NM_001003722
• Protein Refseq: NP_001003722
• MIM: 603371
• Uniprot ID: Q53GS7
• Chromosome Location: 9q34.13