Recombinant Human GLE1
Cat.No. : | GLE1-29066TH |
Product Overview : | Recombinant fragment corresponding to amino acids 140-240 of Human GLE1 with an N terminal proprietary tag; Predicted MWt 36.74 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.740kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELK QHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLK LREAEQQRVKQAEQERLRKEE |
Sequence Similarities : | Belongs to the GLE1 family. |
Gene Name | GLE1 GLE1 RNA export mediator homolog (yeast) [ Homo sapiens ] |
Official Symbol | GLE1 |
Synonyms | GLE1; GLE1 RNA export mediator homolog (yeast); GLE1 (yeast homolog) like, RNA export mediator , GLE1 RNA export mediator (yeast) , GLE1 RNA export mediator like (yeast) , GLE1L, LCCS1, lethal congenital contracture syndrome 1; nucleoporin GLE1; hGLE1; |
Gene ID | 2733 |
mRNA Refseq | NM_001003722 |
Protein Refseq | NP_001003722 |
MIM | 603371 |
Uniprot ID | Q53GS7 |
Chromosome Location | 9q34.13 |
◆ Recombinant Proteins | ||
GLE1-4952H | Recombinant Human GLE1 Protein, GST-tagged | +Inquiry |
GLE1-2561R | Recombinant Rat GLE1 Protein | +Inquiry |
GLE1-1866R | Recombinant Rhesus monkey GLE1 Protein, His-tagged | +Inquiry |
GLE1-2217R | Recombinant Rat GLE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLE1-3593M | Recombinant Mouse GLE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLE1-5906HCL | Recombinant Human GLE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLE1 Products
Required fields are marked with *
My Review for All GLE1 Products
Required fields are marked with *