Recombinant Human GLE1 protein, GST-tagged
| Cat.No. : | GLE1-5322H |
| Product Overview : | Recombinant Human GLE1 protein(1-118 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-118 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GLE1 GLE1 RNA export mediator homolog (yeast) [ Homo sapiens ] |
| Official Symbol | GLE1 |
| Synonyms | GLE1; GLE1 RNA export mediator homolog (yeast); GLE1 (yeast homolog) like, RNA export mediator , GLE1 RNA export mediator (yeast) , GLE1 RNA export mediator like (yeast) , GLE1L, LCCS1, lethal congenital contracture syndrome 1; nucleoporin GLE1; hGLE1; GLE1-like protein; GLE1-like, RNA export mediator; LCCS; GLE1L; LCCS1; |
| Gene ID | 2733 |
| mRNA Refseq | NM_001003722 |
| Protein Refseq | NP_001003722 |
| MIM | 603371 |
| UniProt ID | Q53GS7 |
| ◆ Recombinant Proteins | ||
| GLE1-6399M | Recombinant Mouse GLE1 Protein | +Inquiry |
| GLE1-5327HF | Recombinant Full Length Human GLE1 Protein, GST-tagged | +Inquiry |
| GLE1-1172Z | Recombinant Zebrafish GLE1 | +Inquiry |
| GLE1-2217R | Recombinant Rat GLE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLE1-4952H | Recombinant Human GLE1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLE1-5906HCL | Recombinant Human GLE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLE1 Products
Required fields are marked with *
My Review for All GLE1 Products
Required fields are marked with *



