Recombinant Human GLE1 protein, GST-tagged
Cat.No. : | GLE1-5322H |
Product Overview : | Recombinant Human GLE1 protein(1-118 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-118 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GLE1 GLE1 RNA export mediator homolog (yeast) [ Homo sapiens ] |
Official Symbol | GLE1 |
Synonyms | GLE1; GLE1 RNA export mediator homolog (yeast); GLE1 (yeast homolog) like, RNA export mediator , GLE1 RNA export mediator (yeast) , GLE1 RNA export mediator like (yeast) , GLE1L, LCCS1, lethal congenital contracture syndrome 1; nucleoporin GLE1; hGLE1; GLE1-like protein; GLE1-like, RNA export mediator; LCCS; GLE1L; LCCS1; |
Gene ID | 2733 |
mRNA Refseq | NM_001003722 |
Protein Refseq | NP_001003722 |
MIM | 603371 |
UniProt ID | Q53GS7 |
◆ Recombinant Proteins | ||
GLE1-1866R | Recombinant Rhesus monkey GLE1 Protein, His-tagged | +Inquiry |
Gle1-3223M | Recombinant Mouse Gle1 Protein, Myc/DDK-tagged | +Inquiry |
GLE1-6399M | Recombinant Mouse GLE1 Protein | +Inquiry |
GLE1-5322H | Recombinant Human GLE1 protein, GST-tagged | +Inquiry |
GLE1-2561R | Recombinant Rat GLE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLE1-5906HCL | Recombinant Human GLE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLE1 Products
Required fields are marked with *
My Review for All GLE1 Products
Required fields are marked with *
0
Inquiry Basket