"GPI" Related Products

Expand
Expand

Recombinant Human GPI, His-tagged

Cat.No.: GPI-27616TH
Product Overview: Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa;
Description: This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 161 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL
Sequence Similarities: Belongs to the GPI family.
Gene Name: GPI glucose-6-phosphate isomerase [ Homo sapiens ]
Official Symbol: GPI
Synonyms: GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK;
Gene ID: 2821
mRNA Refseq: NM_000175
Protein Refseq: NP_000166
MIM: 172400
Uniprot ID: P06744
Chromosome Location: 19q13.1
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem;
Function: cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.