Recombinant Human GPI, His-tagged
Cat.No. : | GPI-27616TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 37-297 of Human Glucose 6 phosphate isomerase with an N terminal His tag. Predicted MWt: 30 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 161 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRG VEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVD GKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDV INIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHI AKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFL QAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWD WVGGRYSLWSAIGLSIALHVGFDNFEQLL |
Sequence Similarities : | Belongs to the GPI family. |
Gene Name : | GPI glucose-6-phosphate isomerase [ Homo sapiens ] |
Official Symbol : | GPI |
Synonyms : | GPI; glucose-6-phosphate isomerase; glucose phosphate isomerase; AMF; NLK; |
Gene ID : | 2821 |
mRNA Refseq : | NM_000175 |
Protein Refseq : | NP_000166 |
MIM : | 172400 |
Uniprot ID : | P06744 |
Chromosome Location : | 19q13.1 |
Pathway : | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; |
Function : | cytokine activity; glucose-6-phosphate isomerase activity; growth factor activity; isomerase activity; |
Products Types
◆ Recombinant Protein | ||
GPI-2294R | Recombinant Rat GPI Protein, His (Fc)-Avi-tagged | +Inquiry |
GPI-002H | Recombinant Human GPI Protein, His-tagged | +Inquiry |
GPI-009H | Recombinant Human GPI Protein, His-tagged | +Inquiry |
GPI-1010H | Recombinant Human GPI Protein, His (Fc)-Avi-tagged | +Inquiry |
GPI-059H | Recombinant Human GPI Protein, His-tagged | +Inquiry |
◆ Lysates | ||
GPI-5806HCL | Recombinant Human GPI 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket