Recombinant Human GPRIN1, His-tagged GPRIN1-28587TH

Recombinant Human GPRIN1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GPRIN1, His-tagged

Recombinant Human GPRIN1, His-tagged

GPRIN1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GPRIN1-28587TH
Product Overview : Recombinant fragment, corresponding to amino acids 363-892 of Human GPRIN1 with an N terminal His tag. Predicted mwt: 54 kDa;
Description : GPRIN1 may be involved in neurite outgrowth.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 55 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : TVPATKEDSRFLGKMDPASSGEGRPVSGHTDTTASAKTDL TSLKNVDPMSSGKVDPVSLGKMDPMCSGKPELLSPGQA ERVSVGKAGTVSPGKEDPVSSRREDPISAGSRKTSSEKVN PESSGKTNPVSSGPGDPRSLGTAGPPSAVKAEPATGGK GDPLSSEKAGLVASGKAAPTASGKAEPLAVGKEDPVSK GKADAGPSGQGDSVSIGKVVSTPGKTVPVPSGKVDPVSLG KAEAIPEGKVGSLPLEKGSPVTTTKADPRASGKAQPQS GGKAETKLPGQEGAAAPGEAGAVCLKKETPQASEKVDP GSCRKAEPLASGKGEPVSLGKADSAPSRKTESPSLGKVVP LSLEKTKPSSSSRQLDRKALGSARSPEGARGSEGRVEP KAEPVSSTEASSLGQKDLEAAGAERSPCPEAAAPPPGPRTRDNFTKAPSWEASAPPPPREDAGTQAGAQACVSVAVSP MSPQDGAGGSAFSFQAAPRAPSPPSRRDAGLQVSLGAA ETRSVATGPMTPQAAAPPAFPEVRVR
Gene Name : GPRIN1 G protein regulated inducer of neurite outgrowth 1 [ Homo sapiens ]
Official Symbol : GPRIN1
Synonyms : GPRIN1; G protein regulated inducer of neurite outgrowth 1; G protein-regulated inducer of neurite outgrowth 1; GRIN1; KIAA1893;
Gene ID : 114787
mRNA Refseq : NM_052899
Protein Refseq : NP_443131
MIM : 611239
Uniprot ID : Q7Z2K8
Chromosome Location : 5q35.2
Function : phosphoprotein binding;

Products Types

◆ Recombinant Protein

GPRIN1-7220MRecombinant Mouse GPRIN1 Protein+Inquiry

See All GPRIN1 Recombinant Protein

Related Gene

GPRIN1GPRIN2GPRIN3

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy