"GPRIN1" Related Products

Recombinant Human GPRIN1, His-tagged

Cat.No.: GPRIN1-28587TH
Product Overview: Recombinant fragment, corresponding to amino acids 363-892 of Human GPRIN1 with an N terminal His tag. Predicted mwt: 54 kDa;
Description: GPRIN1 may be involved in neurite outgrowth.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 55 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: TVPATKEDSRFLGKMDPASSGEGRPVSGHTDTTASAKTDL TSLKNVDPMSSGKVDPVSLGKMDPMCSGKPELLSPGQA ERVSVGKAGTVSPGKEDPVSSRREDPISAGSRKTSSEKVN PESSGKTNPVSSGPGDPRSLGTAGPPSAVKAEPATGGK GDPLSSEKAGLVASGKAAPTASGKAEPLAVGKEDPVSK GKADAGPSGQGDSVSIGKVVSTPGKTVPVPSGKVDPVSLG KAEAIPEGKVGSLPLEKGSPVTTTKADPRASGKAQPQS GGKAETKLPGQEGAAAPGEAGAVCLKKETPQASEKVDP GSCRKAEPLASGKGEPVSLGKADSAPSRKTESPSLGKVVP LSLEKTKPSSSSRQLDRKALGSARSPEGARGSEGRVEP KAEPVSSTEASSLGQKDLEAAGAERSPCPEAAAPPPGPRTRDNFTKAPSWEASAPPPPREDAGTQAGAQACVSVAVSP MSPQDGAGGSAFSFQAAPRAPSPPSRRDAGLQVSLGAA ETRSVATGPMTPQAAAPPAFPEVRVR
Gene Name: GPRIN1 G protein regulated inducer of neurite outgrowth 1 [ Homo sapiens ]
Official Symbol: GPRIN1
Synonyms: GPRIN1; G protein regulated inducer of neurite outgrowth 1; G protein-regulated inducer of neurite outgrowth 1; GRIN1; KIAA1893;
Gene ID: 114787
mRNA Refseq: NM_052899
Protein Refseq: NP_443131
MIM: 611239
Uniprot ID: Q7Z2K8
Chromosome Location: 5q35.2
Function: phosphoprotein binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.