"GRIK1" Related Products

Recombinant Human GRIK1

Cat.No.: GRIK1-28537TH
Product Overview: Recombinant fragment of Human GRIK1 amino acids 331-440 with a N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.
Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Most abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWD GLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKH LYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily.
Gene Name: GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
Official Symbol: GRIK1
Synonyms: GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1;
Gene ID: 2897
mRNA Refseq: NM_000830
Protein Refseq: NP_000821
MIM: 138245
Uniprot ID: P39086
Chromosome Location: 21q22
Pathway: Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of Na-permeable Kainate Receptors, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem;
Function: drug binding; extracellular-glutamate-gated ion channel activity; glutamate binding; ion channel activity; kainate selective glutamate receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.