Recombinant Human HABP2

Cat.No. : HABP2-28753TH
Product Overview : Recombinant fragment corresponding to amino acids 105-204 of Human HABP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitously expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
Sequence Similarities : Belongs to the peptidase S1 family.Contains 3 EGF-like domains.Contains 1 kringle domain.Contains 1 peptidase S1 domain.
Gene Name HABP2 hyaluronan binding protein 2 [ Homo sapiens ]
Official Symbol HABP2
Synonyms HABP2; hyaluronan binding protein 2; hyaluronan-binding protein 2; factor VII activating protein; FSAP; HABP; HGFAL; PHBP; plasma hyaluronan binding protein;
Gene ID 3026
mRNA Refseq NM_001177660
Protein Refseq NP_001171131
MIM 603924
Uniprot ID Q14520
Chromosome Location 10q25.3
Function glycosaminoglycan binding; peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HABP2 Products

Required fields are marked with *

My Review for All HABP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon