"HAUS1" Related Products

Expand
Expand

Recombinant Human HAUS1, His-tagged

Cat.No.: HAUS1-26321TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-278 of Human CCDC5 with N terminal His tag, 34kDa.
Description: HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb augmentare, meaning to increase. The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta.
Form: Lyophilised:Reconstitute with 63 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHL SERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLME SVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPA VNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKC LQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRF GIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPL KKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRR VDMMEL
Sequence Similarities: Belongs to the HAUS1 family.
Gene Name: HAUS1 HAUS augmin-like complex, subunit 1 [ Homo sapiens ]
Official Symbol: HAUS1
Synonyms: HAUS1; HAUS augmin-like complex, subunit 1; CCDC5, coiled coil domain containing 5 (spindle associated); HAUS augmin-like complex subunit 1; FLJ40084; HEI C; HsT1461;
Gene ID: 115106
mRNA Refseq: NM_138443
Protein Refseq: NP_612452
MIM: 608775
Uniprot ID: Q96CS2
Chromosome Location: 18q21.1
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.