"HNRNPF" Related Products

Expand
Expand
Expand

Recombinant Human HNRNPF

Cat.No.: HNRNPF-27567TH
Product Overview: Recombinant full length Human hnRNP F with N terminal proprietary tag; Predicted MWt 71.72 kDa.
Description: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein length: 415 amino acids
Molecular Weight: 71.720kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed ubiquitously.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGA AGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGH RYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPF GCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFA SQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLK FMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGY GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIE IGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELF LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGC YGAGYSGQNSMGGYD
Sequence Similarities: Contains 3 RRM (RNA recognition motif) domains.
Gene Name: HNRNPF heterogeneous nuclear ribonucleoprotein F [ Homo sapiens ]
Official Symbol: HNRNPF
Synonyms: HNRNPF; heterogeneous nuclear ribonucleoprotein F; HNRPF;
Gene ID: 3185
mRNA Refseq: NM_001098204
Protein Refseq: NP_001091674
MIM: 601037
Uniprot ID: P52597
Chromosome Location: 10q11.21
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem;
Function: RNA binding; nucleotide binding; protein binding; single-stranded RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.