Recombinant Human HOXC6

Cat.No. : HOXC6-29377TH
Product Overview : Recombinant full length Human HoxC6 with N terminal proprietary tag; Predicted MW 51.92 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 235 amino acids
Description : This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Molecular Weight : 51.920kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTY GAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQE KDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEF HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXC6 homeobox C6 [ Homo sapiens ]
Official Symbol HOXC6
Synonyms HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6;
Gene ID 3223
mRNA Refseq NM_004503
Protein Refseq NP_004494
MIM 142972
Uniprot ID P09630
Chromosome Location 12q13.13
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC6 Products

Required fields are marked with *

My Review for All HOXC6 Products

Required fields are marked with *

0
cart-icon