Recombinant Human HOXC6 protein, His-tagged
Cat.No. : | HOXC6-5645H |
Product Overview : | Recombinant Human HOXC6 protein(1-120 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-120 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI |
Gene Name | HOXC6 homeobox C6 [ Homo sapiens ] |
Official Symbol | HOXC6 |
Synonyms | HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6; homeo box 3C; homeo box C6; homeo box C8 protein; homeobox protein CP25; homeobox protein HHO.C8; homeobox protein Hox-3C; CP25; HOX3; HOX3C; HHO.C8; |
Gene ID | 3223 |
mRNA Refseq | NM_004503 |
Protein Refseq | NP_004494 |
MIM | 142972 |
UniProt ID | P09630 |
◆ Recombinant Proteins | ||
HOXC6-13907H | Recombinant Human HOXC6, GST-tagged | +Inquiry |
HOXC6-1598H | Recombinant Human HOXC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HOXC6-094H | Recombinant Human HOXC6 Protein, HIS-tagged | +Inquiry |
HOXC6-239HF | Recombinant Full Length Human HOXC6 Protein | +Inquiry |
HOXC6-3728HF | Recombinant Full Length Human HOXC6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
HOXC6-5415HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC6 Products
Required fields are marked with *
My Review for All HOXC6 Products
Required fields are marked with *