Recombinant Human HOXC6 protein, His-tagged
| Cat.No. : | HOXC6-5645H |
| Product Overview : | Recombinant Human HOXC6 protein(1-120 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-120 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI |
| Gene Name | HOXC6 homeobox C6 [ Homo sapiens ] |
| Official Symbol | HOXC6 |
| Synonyms | HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6; homeo box 3C; homeo box C6; homeo box C8 protein; homeobox protein CP25; homeobox protein HHO.C8; homeobox protein Hox-3C; CP25; HOX3; HOX3C; HHO.C8; |
| Gene ID | 3223 |
| mRNA Refseq | NM_004503 |
| Protein Refseq | NP_004494 |
| MIM | 142972 |
| UniProt ID | P09630 |
| ◆ Recombinant Proteins | ||
| HOXC6-3728HF | Recombinant Full Length Human HOXC6 Protein, GST-tagged | +Inquiry |
| HOXC6-1598H | Recombinant Human HOXC6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HOXC6-5645H | Recombinant Human HOXC6 protein, His-tagged | +Inquiry |
| HOXC6-13907H | Recombinant Human HOXC6, GST-tagged | +Inquiry |
| Hoxc6-1158M | Recombinant Mouse Hoxc6 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXC6-5415HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
| HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC6 Products
Required fields are marked with *
My Review for All HOXC6 Products
Required fields are marked with *
