Recombinant Full Length Human HOXC6 Protein
Cat.No. : | HOXC6-239HF |
Product Overview : | Recombinant full length Human HoxC6 with N terminal proprietary tag; Predicted MW 51.92 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 51.920kDa inclusive of tags |
Protein Length : | 235 amino acids |
AA Sequence : | MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTY GAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQE KDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEF HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HOXC6 homeobox C6 [ Homo sapiens ] |
Official Symbol : | HOXC6 |
Synonyms : | HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6 |
Gene ID : | 3223 |
mRNA Refseq : | NM_004503 |
Protein Refseq : | NP_004494 |
MIM : | 142972 |
UniProt ID : | P09630 |
Products Types
◆ Recombinant Protein | ||
HOXC6-4983H | Recombinant Human HOXC6 Protein, GST-tagged | +Inquiry |
Hoxc6-1158M | Recombinant Mouse Hoxc6 Protein, MYC/DDK-tagged | +Inquiry |
HOXC6-094H | Recombinant Human HOXC6 Protein, HIS-tagged | +Inquiry |
HOXC6-29377TH | Recombinant Human HOXC6 | +Inquiry |
HOXC6-13907H | Recombinant Human HOXC6, GST-tagged | +Inquiry |
◆ Lysates | ||
HOXC6-5415HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket