Recombinant Full Length Human HOXC6 Protein

Cat.No. : HOXC6-239HF
Product Overview : Recombinant full length Human HoxC6 with N terminal proprietary tag; Predicted MW 51.92 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 235 amino acids
Description : This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons.
Form : Liquid
Molecular Mass : 51.920kDa inclusive of tags
AA Sequence : MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTY GAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQE KDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEF HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name HOXC6 homeobox C6 [ Homo sapiens ]
Official Symbol HOXC6
Synonyms HOXC6; homeobox C6; homeo box C6 , HOX3, HOX3C; homeobox protein Hox-C6
Gene ID 3223
mRNA Refseq NM_004503
Protein Refseq NP_004494
MIM 142972
UniProt ID P09630

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXC6 Products

Required fields are marked with *

My Review for All HOXC6 Products

Required fields are marked with *

0
cart-icon
0
compare icon