"HPGD" Related Products

Expand
Expand

Recombinant Human HPGD, His-tagged

Cat.No.: HPGD-31206TH
Product Overview: Recombinant full length Human Prostaglandin dehydrogenase 1 with an N terminal His tag; 286 amino acids with a predicted MWt 31.1kDa including tag.
Description: This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 266 amino acids
Conjugation: HIS
Molecular Weight: 31.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Detected in colon epithelium (at protein level).
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name: HPGD hydroxyprostaglandin dehydrogenase 15-(NAD) [ Homo sapiens ]
Official Symbol: HPGD
Synonyms: HPGD; hydroxyprostaglandin dehydrogenase 15-(NAD); 15-hydroxyprostaglandin dehydrogenase [NAD+]; SDR36C1; short chain dehydrogenase/reductase family 36C; member 1;
Gene ID: 3248
mRNA Refseq: NM_000860
Protein Refseq: NP_000851
MIM: 601688
Uniprot ID: P15428
Chromosome Location: 4q34-q35
Pathway: Prostaglandin Synthesis and Regulation, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; 15-hydroxyprostaglandin dehydrogenase (NAD+) activity; NAD binding; NAD+ binding; catalytic activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.