"HPGDS" Related Products

Expand
Expand

Recombinant Human HPGDS

Cat.No.: HPGDS-30587TH
Product Overview: Recombinant full length Human Prostaglandin D Synthase produced in Saccharomyces cerevisiae; amino acids 1-199 , 23.3kDa.
Description: Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Form: Liquid
Purity: Immunogen affinity purified
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWP EIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLA GNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMF NELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEIC STTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRR PQTKL
Gene Name: HPGDS hematopoietic prostaglandin D synthase [ Homo sapiens ]
Official Symbol: HPGDS
Synonyms: HPGDS; hematopoietic prostaglandin D synthase; glutathione S transferase sigma; GSTS; H PGDS; PGDS;
Gene ID: 27306
mRNA Refseq: NM_014485
Protein Refseq: NP_055300
MIM: 602598
Uniprot ID: O60760
Chromosome Location: 4q22.2
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: calcium ion binding; glutathione transferase activity; isomerase activity; magnesium ion binding; prostaglandin-D synthase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.